Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitogen-activated protein kinase 14 (Mapk14)

This Recombinant Mouse Mitogen-activated protein kinase 14 (Mapk14) spans the amino acid sequence from region 2-360aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MAP kinase 14) (MAPK 14) (CRK1) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha)

UniProt

P47811

Expression Region

2-360aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPS2 Antibody
KC-42830-01 50 μL

CAPS2 Antibody

Sign In for Pricing
View Details
CAPS2 Antibody
KC-42830-02 100 µL

CAPS2 Antibody

Sign In for Pricing
View Details
CAPS2 Antibody
KC-42830-03 1 mL

CAPS2 Antibody

Sign In for Pricing
View Details
Formyl Polystyrene
H40007.25G 25 g

Formyl Polystyrene

Sign In for Pricing
View Details
PFDN1 Rabbit Polyclonal Antibody
AP20401PU-N 100 µg

PFDN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human OCLN Protein (His Tag)
PDEH100527-01 20 µg

Recombinant Human OCLN Protein (His Tag)

Sign In for Pricing
View Details