Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peptide YY (Pyy), partial

This Recombinant Mouse Peptide YY (Pyy), partial spans the amino acid sequence from region 29-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PYY) (Peptide tyrosine tyrosine) (3-36) (PYY-II)

UniProt

Q9EPS2

Expression Region

29-64aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Aminoisoquinoline
sc-222660 1 g

1-Aminoisoquinoline

Sign In for Pricing
View Details
Villin (VIL1) Rabbit Polyclonal Antibody
TA358828 100 µL

Villin (VIL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IER3 sgRNA CRISPR Lentivector set (Human)
K1015901 3x 1.0 µg

IER3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rho A (26C4) TRITC
sc-418 TRITC 200 µg/mL

Rho A (26C4) TRITC

Sign In for Pricing
View Details
Exosc4 (NM_175399) Mouse Tagged ORF Clone Lentiviral Particle
MR203072L3V 200 µL

Exosc4 (NM_175399) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sphingosine-1-phosphate, EDG receptor agonist
TBI4526-1MG 1 mg

Sphingosine-1-phosphate, EDG receptor agonist

Sign In for Pricing
View Details