Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reduced folate transporter (SLC19A1), partial

This Recombinant Human Reduced folate transporter (SLC19A1), partial spans the amino acid sequence from region 420-591aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FOLT) (Cyclic dinucleotide:anion antiporter SLC19A1) (Folate:anion antiporter SLC19A1) (Intestinal folate carrier 1) (IFC-1) (Placental folate transporter) (Reduced folate carrier protein) (RFC) (hRFC) (Reduced folate transporter 1) (RFT-1) (Solute carrier family 19 member 1) (hSLC19A1)

UniProt

P41440

Expression Region

420-591aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H12D polyclonal antibody
orb1719312-01 50 µL

ZC3H12D polyclonal antibody

Sign In for Pricing
View Details
ZC3H12D polyclonal antibody
orb1719312-02 100 µL

ZC3H12D polyclonal antibody

Sign In for Pricing
View Details
KIAA0556 siRNA (Human)
MBS8225898-01 15 nmol

KIAA0556 siRNA (Human)

Sign In for Pricing
View Details
KIAA0556 siRNA (Human)
MBS8225898-02 30 nmol

KIAA0556 siRNA (Human)

Sign In for Pricing
View Details
KIAA0556 siRNA (Human)
MBS8225898-03 5x 30 nmol

KIAA0556 siRNA (Human)

Sign In for Pricing
View Details
IgM ELISA Kit (Pig) (OKIA00121)
OKIA00121 96 Well

IgM ELISA Kit (Pig) (OKIA00121)

Sign In for Pricing
View Details