Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thiamine transporter 1 (SLC19A2), partial

This Recombinant Human Thiamine transporter 1 (SLC19A2), partial spans the amino acid sequence from region 215-293aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ThTr-1) (ThTr1) (Solute carrier family 19 member 2) (Thiamine carrier 1) (TC1)

UniProt

O60779

Expression Region

215-293aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin beta A chain/Activin A/INHBA
MBS8532901-01 0.01 mg

Inhibin beta A chain/Activin A/INHBA

Sign In for Pricing
View Details
Inhibin beta A chain/Activin A/INHBA
MBS8532901-02 5x 0.01 mg

Inhibin beta A chain/Activin A/INHBA

Sign In for Pricing
View Details
RN5S29 Protein Vector (Human) (pPM-C-HA)
PV116760 500 ng

RN5S29 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
FGF R1 alpha, Recombinant, Human, aa22-374, His-Tag
532300-01 50 µg

FGF R1 alpha, Recombinant, Human, aa22-374, His-Tag

Sign In for Pricing
View Details
FGF R1 alpha, Recombinant, Human, aa22-374, His-Tag
532300-02 100 µg

FGF R1 alpha, Recombinant, Human, aa22-374, His-Tag

Sign In for Pricing
View Details
Coumaperine
BUP03158-01 5 mg

Coumaperine

Sign In for Pricing
View Details