Recombinant Human Elongin-C (ELOC), Biotinylated
This Recombinant Human Elongin-C (ELOC), Biotinylated spans the amino acid sequence from region 1-112aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(EloC) (Elongin 15 kDa subunit) (RNA polymerase II transcription factor SIII subunit C) (SIII p15) (Transcription elongation factor B polypeptide 1)
UniProt
Q15369
Expression Region
1-112aa
Tag
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
60.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7148332 Inquire
Rabbit anti-Escherichia coli (strain K12) YDFR Polyclonal Antibody
Sign In for Pricing
View Details 
VAng-Yyj3237-50gEcoli 50 µg (E. coli)
Recombinant Mycobacterium Bovis BCG_2973 Protein (aa 1-270)
Sign In for Pricing
View Details orb1662067 96 Tests
Rat Cd38/ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 ELISA Kit
Sign In for Pricing
View Details K7085506 1.0 µg DNA
Tspan2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details