Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Trichohyalin (TCHH), partial

This Recombinant human Trichohyalin (TCHH), partial spans the amino acid sequence from region 1854-1943aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q07283

Expression Region

1854-1943aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEYIQEQRSQYRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN1A/p21 Rabbit Polyclonal Antibody (BF647)
orb1607305 100 µL

CDKN1A/p21 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
MRPL2 Protein Vector (Rat) (pPB-N-His)
PV283083 500 ng

MRPL2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Progesterone Receptor Antibody
orb1317008 100 µL

Progesterone Receptor Antibody

Sign In for Pricing
View Details
Rat Pde4a / cAMP-specific 3',5'-cyclic phosphodiesterase 4A ELISA Kit
MBS2906171-01 48 Well

Rat Pde4a / cAMP-specific 3',5'-cyclic phosphodiesterase 4A ELISA Kit

Sign In for Pricing
View Details
Rat Pde4a / cAMP-specific 3',5'-cyclic phosphodiesterase 4A ELISA Kit
MBS2906171-02 96 Well

Rat Pde4a / cAMP-specific 3',5'-cyclic phosphodiesterase 4A ELISA Kit

Sign In for Pricing
View Details
Rat Pde4a / cAMP-specific 3',5'-cyclic phosphodiesterase 4A ELISA Kit
MBS2906171-03 5x 96 Well

Rat Pde4a / cAMP-specific 3',5'-cyclic phosphodiesterase 4A ELISA Kit

Sign In for Pricing
View Details