Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Envelope glycoprotein UL132 (UL132), partial, Biotinylated

This Recombinant Human cytomegalovirus Envelope glycoprotein UL132 (UL132), partial, Biotinylated spans the amino acid sequence from region 157-270aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(L3)

UniProt

P69339

Expression Region

157-270aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain Towne) (HHV-5) (Human herpesvirus 5)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPYQRLETRDWDEEEEASAARERMKHDPENVIYFRKDGNLDTSFVNPNYGRGSPLTIESHLSDNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Neurofilament Light Polypeptide ELISA Kit
IMSNEFLKT 1 Each

Mouse Neurofilament Light Polypeptide ELISA Kit

Sign In for Pricing
View Details
PPP1R14BP3 Protein Vector (Human) (pPM-C-HA)
37414021 500 ng

PPP1R14BP3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
LPAR5 Peptide - C-terminal region
MBS3241606-01 0.1 mg

LPAR5 Peptide - C-terminal region

Sign In for Pricing
View Details
LPAR5 Peptide - C-terminal region
MBS3241606-02 5x 0.1 mg

LPAR5 Peptide - C-terminal region

Sign In for Pricing
View Details
CEP350 Antibody
CSB-PA080077-01 50 µg

CEP350 Antibody

Sign In for Pricing
View Details
CEP350 Antibody
CSB-PA080077-02 100 µg

CEP350 Antibody

Sign In for Pricing
View Details