Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Scaffold protein OPG125 (OPG125), partial

This Recombinant Vaccinia virus Scaffold protein OPG125 (OPG125), partial spans the amino acid sequence from region 1-230aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(62 kDa protein) (Rifampicin resistance protein)

UniProt

P68441

Expression Region

1-230aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNNTIINSLIGGDDSIKRSNVFAVDSQIPTLYMPQYISLSGVMTNDGPDNQAIASFEIRDQYITALNHLVLSLELPEVKGMGRFGYVPYVGYKCINHVSISSCNGVIWEIEGEELYNNCINNTIALKHSGYSSELNDISIGLTPNDTIKEPSTVYVYIKTPFDVEDTFSSLKLSDSKITVTVTFNPVSDIVIRDSSFDFETFNKEFVYVPELSFIGYMVKNVQIKPSFIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMB3 Antibody : HRP (OAAF03034-HRP)
OAAF03034-100UG-HRP 100 µg

LAMB3 Antibody : HRP (OAAF03034-HRP)

Sign In for Pricing
View Details
Anti-POP4 Antibody Picoband® Fluoro594 Conjugated
A10082-2-Fluoro594 100 µg/Vial

Anti-POP4 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Rabbit anti-mouse Major urinary proteins 11 and 8 polyclonal Antibody, Biotin conjugated
MBS1489019-01 0.05 mg

Rabbit anti-mouse Major urinary proteins 11 and 8 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-mouse Major urinary proteins 11 and 8 polyclonal Antibody, Biotin conjugated
MBS1489019-02 0.1 mg

Rabbit anti-mouse Major urinary proteins 11 and 8 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-mouse Major urinary proteins 11 and 8 polyclonal Antibody, Biotin conjugated
MBS1489019-03 5x 0.1 mg

Rabbit anti-mouse Major urinary proteins 11 and 8 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
TMOD3 siRNA (Mouse)
MBS8215437-01 15 nmol

TMOD3 siRNA (Mouse)

Sign In for Pricing
View Details