Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hordeum vulgare Gamma-hordein-3

This Recombinant Hordeum vulgare Gamma-hordein-3 spans the amino acid sequence from region 1-289aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P80198

Expression Region

1-289aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Hordeum vulgare (Barley)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ITTTTMQFNPSGLELERPQQLFPQWQPLPQQPPFLQQEPEQPYPQQQPLPQQQPFPQQPQLPHQHQFPQQLPQQQFPQQMPLQPQQQFPQQMPLQPQQQPQFPQQKPFGQYQQPLTQQPYPQQQPLAQQQPSIEEQHQLNLCKEFLLQQCTLDEKVPLLQSVISFLRPHISQQNSCQLKRQQCCQQLANINEQSRCPAIQTIVHAIVMQQQVQQQVGHGFVQSQLQQLGQGMPIQLQQQPGQAFVLPQQQAQFKVVGSLVIQTLPMLCNVHVPPYCSPFGSMATGSGGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DIABLO Protein, N-His
bs-103944P-01 20 µg

Recombinant Human DIABLO Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DIABLO Protein, N-His
bs-103944P-02 50 µg

Recombinant Human DIABLO Protein, N-His

Sign In for Pricing
View Details
Lentiviral mouse Sema4c shRNA (UAS) - Lentiviral mouseSema4c shRNA (UAS, GFP) (25)
GTR15280352 1 Vial

Lentiviral mouse Sema4c shRNA (UAS) - Lentiviral mouseSema4c shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
CLASP2 Rabbit Polyclonal Antibody
orb666316-01 30 µL

CLASP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLASP2 Rabbit Polyclonal Antibody
orb666316-02 50 μL

CLASP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLASP2 Rabbit Polyclonal Antibody
orb666316-03 100 µL

CLASP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details