Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease inhibitor A3K (Serpina3k)

This Recombinant Mouse Serine protease inhibitor A3K (Serpina3k) spans the amino acid sequence from region 22-418aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Serpin A3K) (Contrapsin) (SPI-2)

UniProt

P07759

Expression Region

22-418aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPDGTKEMDIVFHEHQDNGTQDDSLTLASVNTDFAFSLYKKLALKNPDTNIVFSPLSISAALALVSLGAKGKTMEEILEGLKFNLTETPEADIHQGFGNLLQSLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPTEAKNLINDYVSNQTQGMIKELISELDERTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSVKVPMMKMKLLTTRHFRDEELSCSVLELKYTGNASALLILPDQGRMQQVEASLQPETLRKWRKTLFPSQIEELNLPKFSIASNYRLEEDVLPEMGIKEVFTEQADLSGITETKKLSVSQVVHKAVLDVAETGTEAAAATGVIGGIRKAILPAVHFNRPFLFVIYHTSAQSILFMAKVNNPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLN13, CT (SLFN13, Schlafen family member 13) (Azide free) (HRP) discontinued
042014-HRP 200 µL

SLN13, CT (SLFN13, Schlafen family member 13) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Ubqln1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3466002 1.0 µg DNA

Ubqln1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Anti-gp140 (Clade B)
IT-001-002M9-01 0.1 mg

Anti-gp140 (Clade B)

Sign In for Pricing
View Details
Anti-gp140 (Clade B)
IT-001-002M9-02 0.5 mg

Anti-gp140 (Clade B)

Sign In for Pricing
View Details
Rat Coiled-coil domain-containing protein 135 (CCDC135) ELISA Kit
MBS7253496-01 48 Well

Rat Coiled-coil domain-containing protein 135 (CCDC135) ELISA Kit

Sign In for Pricing
View Details
Rat Coiled-coil domain-containing protein 135 (CCDC135) ELISA Kit
MBS7253496-02 96 Well

Rat Coiled-coil domain-containing protein 135 (CCDC135) ELISA Kit

Sign In for Pricing
View Details