Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein RRP5 homolog (PDCD11), partial

This Recombinant Human Protein RRP5 homolog (PDCD11), partial spans the amino acid sequence from region 1200-1420aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(NF-kappa-B-binding protein) (NFBP) (Programmed cell death protein 11)

UniProt

Q14690

Expression Region

1200-1420aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQALRATVVGPDSSKTLLCLSLTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oas1h (NM_001009491) Rat Tagged Lenti ORF Clone
RR213714L3 10 µg

Oas1h (NM_001009491) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IGLV3-25 Recombinant Protein (Human)
RP015853 100 µg

IGLV3-25 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rabbit anti-human polo-like kinase 3 (Drosophila) polyclonal Antibody
MBS716457-01 0.1 mL

Rabbit anti-human polo-like kinase 3 (Drosophila) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human polo-like kinase 3 (Drosophila) polyclonal Antibody
MBS716457-02 5x 0.1 mL

Rabbit anti-human polo-like kinase 3 (Drosophila) polyclonal Antibody

Sign In for Pricing
View Details
Human Gamma-Glutamyl Hydrolase ELISA Kit
MBS087715-01 48 Well

Human Gamma-Glutamyl Hydrolase ELISA Kit

Sign In for Pricing
View Details
Human Gamma-Glutamyl Hydrolase ELISA Kit
MBS087715-02 96 Well

Human Gamma-Glutamyl Hydrolase ELISA Kit

Sign In for Pricing
View Details