Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell CLL/lymphoma 7 protein family member A (BCL7A)

This Recombinant Human B-cell CLL/lymphoma 7 protein family member A (BCL7A) spans the amino acid sequence from region 1-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q4VC05

Expression Region

1-210aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RELM alpha Polyclonal Antibody, Cy5 Conjugated
bs-1884R-Cy5 100 µL

RELM alpha Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
SOX6 Rabbit pAb, Pacific Blue conjugated
orb2869517 100 µL

SOX6 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
KRT37 ORF Vector (Human) (pORF)
ORF022441 1.0 µg DNA

KRT37 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TTC8 Blocking Peptide
33R-2599 0.1 mg

TTC8 Blocking Peptide

Sign In for Pricing
View Details
Anti-Echinoderm Microtubule Associated Protein Like Protein 2 (EML2)
FY-AB50116-01 1 mL

Anti-Echinoderm Microtubule Associated Protein Like Protein 2 (EML2)

Sign In for Pricing
View Details
Anti-Echinoderm Microtubule Associated Protein Like Protein 2 (EML2)
FY-AB50116-02 100 µL

Anti-Echinoderm Microtubule Associated Protein Like Protein 2 (EML2)

Sign In for Pricing
View Details