Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vesicular glutamate transporter 3 (Slc17a8), partial

This Recombinant Rat Vesicular glutamate transporter 3 (Slc17a8), partial spans the amino acid sequence from region 1-76aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(VGluT3) (Solute carrier family 17 member 8)

UniProt

Q7TSF2

Expression Region

1-76aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPFNAFDTFKEKILKPGKEGVKNAVGDSLGILQRKLDGTNEEGDAIELSEEGRPVQTSRARAPVCDCSCCGIPKRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TARDBP (1-414) Human, TAR DNA Binding Protein (1-414 a.a.) Human Recombinant Protein, His Tag
PROTQ13148-1 20 µg

TARDBP (1-414) Human, TAR DNA Binding Protein (1-414 a.a.) Human Recombinant Protein, His Tag

Sign In for Pricing
View Details
MRP-L47 Polyclonal Antibody
UB-GEN-3910 100 µL

MRP-L47 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CoREST2/RCOR2 Rabbit pAb
GB113577-100 100 μL

Anti-CoREST2/RCOR2 Rabbit pAb

Sign In for Pricing
View Details
Epha4, ID (Epha4, Sek, Sek1, Ephrin type-A receptor 4, Tyrosine-protein kinase receptor MPK-3, Tyrosine-protein kinase receptor SEK-1) (MaxLight 405)
MBS6296001-01 0.1 mL

Epha4, ID (Epha4, Sek, Sek1, Ephrin type-A receptor 4, Tyrosine-protein kinase receptor MPK-3, Tyrosine-protein kinase receptor SEK-1) (MaxLight 405)

Sign In for Pricing
View Details
Epha4, ID (Epha4, Sek, Sek1, Ephrin type-A receptor 4, Tyrosine-protein kinase receptor MPK-3, Tyrosine-protein kinase receptor SEK-1) (MaxLight 405)
MBS6296001-02 5x 0.1 mL

Epha4, ID (Epha4, Sek, Sek1, Ephrin type-A receptor 4, Tyrosine-protein kinase receptor MPK-3, Tyrosine-protein kinase receptor SEK-1) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein PB18E9.05c (SPAPB18E9.05c), partial
MBS7094901 Inquire

Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein PB18E9.05c (SPAPB18E9.05c), partial

Sign In for Pricing
View Details