Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vesicular glutamate transporter 2 (Slc17a6), partial

This Recombinant Rat Vesicular glutamate transporter 2 (Slc17a6), partial spans the amino acid sequence from region 499-582aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(VGluT2) (Differentiation-associated BNPI) (Differentiation-associated Na (+) (Solute carrier family 17 member 6)

UniProt

Q9JI12

Expression Region

499-582aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BMP-1/PCP Antibody (OTI3E9) [DyLight 550]
NBP2-70255R 0.1 mL

Mouse Monoclonal BMP-1/PCP Antibody (OTI3E9) [DyLight 550]

Sign In for Pricing
View Details
Mouse Monoclonal PKC iota Antibody (PRKCI/4911) [Alexa Fluor 488]
NBP3-14155AF488 0.1 mL

Mouse Monoclonal PKC iota Antibody (PRKCI/4911) [Alexa Fluor 488]

Sign In for Pricing
View Details
ACTB Antibody
orb3162213-01 50 µL

ACTB Antibody

Sign In for Pricing
View Details
ACTB Antibody
orb3162213-02 100 µL

ACTB Antibody

Sign In for Pricing
View Details
OSGIN2 Mouse Monoclonal Antibody [Clone 1C7]
E45M18711V-2 50 µL

OSGIN2 Mouse Monoclonal Antibody [Clone 1C7]

Sign In for Pricing
View Details
ZNF213 CRISPR Activation Plasmid (h)
sc-411109-ACT 20 µg

ZNF213 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details