Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Prorelaxin (RLN)

This Recombinant Dog Prorelaxin (RLN) spans the amino acid sequence from region 26-177aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9TRM8

Expression Region

26-177aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRERRQISEPLAEVVPSSIINDPEILSLMLQSIPGMPQELRIATRSGKEKLLRELHFVLEDSNLNLEEMKKTFLNTQFEAEDKSLSKLDKHPRKKRDNYIKMSDKCCNVGCTRRELASRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E9]
TA802861AM 100 µL

MRPS11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E9]

Sign In for Pricing
View Details
Ubc Mouse Gene Knockout Kit (CRISPR)
KN518560 1 Kit

Ubc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MDP1 (NM_138476) Human Over-expression Lysate
LC403357 20 µg

MDP1 (NM_138476) Human Over-expression Lysate

Sign In for Pricing
View Details
ABCD1 Rabbit Polyclonal Antibody
TA371952 100 µL

ABCD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CAT Antibody
RC-6964-01 50 μL

Recombinant CAT Antibody

Sign In for Pricing
View Details
Recombinant CAT Antibody
RC-6964-02 100 µL

Recombinant CAT Antibody

Sign In for Pricing
View Details