Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA-directed RNA polymerase III subunit RPC10 (POLR3K)

This Recombinant Human DNA-directed RNA polymerase III subunit RPC10 (POLR3K) spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(RNA polymerase III subunit C10) (DNA-directed RNA polymerase III subunit K) (RNA polymerase III 12.5 kDa subunit) (RPC12.5) (RNA polymerase III subunit C11) (HsC11p) (RPC11) (hRPC11)

UniProt

Q9Y2Y1

Expression Region

1-108aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1,1-Trifluoromethanesulfonic Acid 2- (2-Propen-1-yl) phenyl Ester-d4
410428-01 5 mg

1,1,1-Trifluoromethanesulfonic Acid 2- (2-Propen-1-yl) phenyl Ester-d4

Sign In for Pricing
View Details
1,1,1-Trifluoromethanesulfonic Acid 2- (2-Propen-1-yl) phenyl Ester-d4
410428-02 25 mg

1,1,1-Trifluoromethanesulfonic Acid 2- (2-Propen-1-yl) phenyl Ester-d4

Sign In for Pricing
View Details
GRP78 (HSPA5) (NM_005347) Human Mass Spec Standard
PH305859 10 µg

GRP78 (HSPA5) (NM_005347) Human Mass Spec Standard

Sign In for Pricing
View Details
CYP2U1 Polyclonal Antibody
UB-GEN-2533 100 µL

CYP2U1 Polyclonal Antibody

Sign In for Pricing
View Details
Integrin alpha 4 (ITGA4/CD49d) Rabbit pAb
E45R17525N-100 100 µL

Integrin alpha 4 (ITGA4/CD49d) Rabbit pAb

Sign In for Pricing
View Details
C10orf114 Protein Lysate (Human) with C-Ha Tag
13617031 100 µg

C10orf114 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details