Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Apoptosis regulator Bcl-2 (Bcl2)

This Recombinant Rat Apoptosis regulator Bcl-2 (Bcl2) spans the amino acid sequence from region 1-236aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P49950

Expression Region

1-236aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A14 Lentiviral Activation Particles (h)
sc-410476-LAC 200 µL

SLC7A14 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Cyclin A (FITC)
C8452-08-FITC 100 µL

Cyclin A (FITC)

Sign In for Pricing
View Details
Lentiviral human NT5C1A shRNA (UAS) - Lentiviral human NT5C1A shRNA (UAS, GFP) (25)
GTR15341135 1 Vial

Lentiviral human NT5C1A shRNA (UAS) - Lentiviral human NT5C1A shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated
orb3008931-01 20 µg

Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated
orb3008931-02 100 µg

Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated
orb3008931-03 1 mg

Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated

Sign In for Pricing
View Details