Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Larimichthys crocea Odorant receptor

This Recombinant Larimichthys crocea Odorant receptor spans the amino acid sequence from region 1-308aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

F2XEX3

Expression Region

1-308aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMDNVSKLTIFTLSGLHEIANYRVTLFVLTLLCYCVIWLINLAIIVTIIMDKSLHEPMYIFLCNLCINGLYETAGFYPKFLIDLLSTFHVISYAGCLLQGFVLHSSACADFSILVLMAYDRYVAICRPLVYHSVMTTQRVCVFIFFAWLIPLYLVFMSSITTARSRLCGSHIPKIYCINFLVGKLACTTSIANVIIPAFNYTFYFLHVMFIAWSYMYLIRKCLISSENRSKFMQTCLPHLICLIIVVVSLLFDLLYMRFGSQTLSQNVKNFMAMEFLLVPPIINPLIYGFKLTQIRNRIIQFLSGKRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMC5 Antibody
CSB-PA810294LA01HU-01 50 µg

SMC5 Antibody

Sign In for Pricing
View Details
SMC5 Antibody
CSB-PA810294LA01HU-02 100 µg

SMC5 Antibody

Sign In for Pricing
View Details
Sox10 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7539303 1.0 µg DNA

Sox10 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
19 (R) -HETE
T36216-01 25 µg

19 (R) -HETE

Sign In for Pricing
View Details
19 (R) -HETE
T36216-02 50 µg

19 (R) -HETE

Sign In for Pricing
View Details
19 (R) -HETE
T36216-03 100 µg

19 (R) -HETE

Sign In for Pricing
View Details