Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Apoptosis regulator Bcl-2 (BCL2)

This Recombinant Dog Apoptosis regulator Bcl-2 (BCL2) spans the amino acid sequence from region 1-236aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6R755

Expression Region

1-236aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alpha 5 (ITGA5) (NM_002205) Human Recombinant Protein
TP720399XL 1 mg

Integrin alpha 5 (ITGA5) (NM_002205) Human Recombinant Protein

Sign In for Pricing
View Details
SLCO5A1 Peptide - middle region
orb2008946 100 µg

SLCO5A1 Peptide - middle region

Sign In for Pricing
View Details
HP1BP3 (N) Antibody, Rabbit Polyclonal
orb67240 100 µL

HP1BP3 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Bovine Glial Fibrillary Acidic Protein (GFAP) ELISA Kit
NSL0303Bo 96 Tests

Bovine Glial Fibrillary Acidic Protein (GFAP) ELISA Kit

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ubiquitin Conjugating Enzyme E2I (UBE2I)
MBS2074786-01 0.1 mL

APC-Linked Polyclonal Antibody to Ubiquitin Conjugating Enzyme E2I (UBE2I)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ubiquitin Conjugating Enzyme E2I (UBE2I)
MBS2074786-02 0.2 mL

APC-Linked Polyclonal Antibody to Ubiquitin Conjugating Enzyme E2I (UBE2I)

Sign In for Pricing
View Details