Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial thiamine pyrophosphate carrier (SLC25A19)

This Recombinant Human Mitochondrial thiamine pyrophosphate carrier (SLC25A19) spans the amino acid sequence from region 1-320aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Mitochondrial uncoupling protein 1) (Solute carrier family 25 member 19)

UniProt

Q9HC21

Expression Region

1-320aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R5E (m) -PR
sc-152427-PR 10 µM - 20 µL

PPP2R5E (m) -PR

Sign In for Pricing
View Details
SIRP alpha Protein, Mouse, Recombinant (hFc Tag)
E45M53365M4-100 100 µg

SIRP alpha Protein, Mouse, Recombinant (hFc Tag)

Sign In for Pricing
View Details
Rabbit Polyclonal MLC1SA Antibody
NBP3-03351-20ul 20 µL

Rabbit Polyclonal MLC1SA Antibody

Sign In for Pricing
View Details
Human HOXB7 (Homeobox protein Hox-B7) ELISA Kit
MBS7606548-01 48 Well

Human HOXB7 (Homeobox protein Hox-B7) ELISA Kit

Sign In for Pricing
View Details
Human HOXB7 (Homeobox protein Hox-B7) ELISA Kit
MBS7606548-02 96 Well

Human HOXB7 (Homeobox protein Hox-B7) ELISA Kit

Sign In for Pricing
View Details
Human HOXB7 (Homeobox protein Hox-B7) ELISA Kit
MBS7606548-03 5x 96 Well

Human HOXB7 (Homeobox protein Hox-B7) ELISA Kit

Sign In for Pricing
View Details