Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin E3 (SERPINE3)

This Recombinant Human Serpin E3 (SERPINE3) spans the amino acid sequence from region 21-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A8MV23

Expression Region

21-424aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HLREGMTLLKTEFALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKRVKDFLHAVYATLPTSSQGTEMELACSLFVQVGTPLSPCFVEHVSWWANSSLEPADLSEPNSTAIQTSEGASRETAGGGPSEGPGGWPWEQVSAAFAQLVLVSTMSFQGTWRKRFSSTDTQILPFTCAYGLVLQVPMMHQTTEVNYGQFQDTAGHQVGVLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGISGQDGFYVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYPLKNKHSF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX39B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV667539 1.0 µg DNA

DDX39B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
BAD (Phospho-Ser112) Colorimetric Cell-Based ELISA Kit
EKC2358 1 Kit, Containing two 96 Well Plates and all necessary reagents

BAD (Phospho-Ser112) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
4,4-Difluoro-2,2-dimethylcyclohexan-1-amine hydrochloride
FSD25570-01 50 mg

4,4-Difluoro-2,2-dimethylcyclohexan-1-amine hydrochloride

Sign In for Pricing
View Details
4,4-Difluoro-2,2-dimethylcyclohexan-1-amine hydrochloride
FSD25570-02 0.5 g

4,4-Difluoro-2,2-dimethylcyclohexan-1-amine hydrochloride

Sign In for Pricing
View Details
Rabbit anti-PITRM1 Antibody
YLD6187-01 50 µL

Rabbit anti-PITRM1 Antibody

Sign In for Pricing
View Details
Rabbit anti-PITRM1 Antibody
YLD6187-02 100 µL

Rabbit anti-PITRM1 Antibody

Sign In for Pricing
View Details