Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin E3 (SERPINE3)

This Recombinant Human Serpin E3 (SERPINE3) spans the amino acid sequence from region 21-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A8MV23

Expression Region

21-424aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HLREGMTLLKTEFALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKRVKDFLHAVYATLPTSSQGTEMELACSLFVQVGTPLSPCFVEHVSWWANSSLEPADLSEPNSTAIQTSEGASRETAGGGPSEGPGGWPWEQVSAAFAQLVLVSTMSFQGTWRKRFSSTDTQILPFTCAYGLVLQVPMMHQTTEVNYGQFQDTAGHQVGVLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGISGQDGFYVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYPLKNKHSF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cyclin A2 Antibody (E67) [DyLight 405]
NBP2-34613V 0.1 mL

Mouse Monoclonal Cyclin A2 Antibody (E67) [DyLight 405]

Sign In for Pricing
View Details
Donkey anti Goat IgG (heavy and light chains), conjugated with Biotin
DoAG/IgG(H+L)/Bio 1 mL

Donkey anti Goat IgG (heavy and light chains), conjugated with Biotin

Sign In for Pricing
View Details
ROCK2 polyclonal antibody
BS91176 50ul

ROCK2 polyclonal antibody

Sign In for Pricing
View Details
MAP4 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-4128R-BF488 100 µL

MAP4 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
APC anti-mouse CD8a
E16FMA008a-025U 25 µg

APC anti-mouse CD8a

Sign In for Pricing
View Details
Involucrin (Inv, Invo, IVL) (FITC)
168811-AF-FITC 100 µL

Involucrin (Inv, Invo, IVL) (FITC)

Sign In for Pricing
View Details