Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin E3 (SERPINE3)

This Recombinant Human Serpin E3 (SERPINE3) spans the amino acid sequence from region 21-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A8MV23

Expression Region

21-424aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HLREGMTLLKTEFALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKRVKDFLHAVYATLPTSSQGTEMELACSLFVQVGTPLSPCFVEHVSWWANSSLEPADLSEPNSTAIQTSEGASRETAGGGPSEGPGGWPWEQVSAAFAQLVLVSTMSFQGTWRKRFSSTDTQILPFTCAYGLVLQVPMMHQTTEVNYGQFQDTAGHQVGVLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGISGQDGFYVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYPLKNKHSF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR2 (Toll Like Receptor 2, Toll-like Receptor 2 Precursor, TLR 2, TLR-2, CD282, CD282 Antigen, Toll/interleukin 1 Receptor-like 4, Toll/interleukin Receptor-like Protein 4, TIL4) (Carboxyfluorescein) discontinued
T8050-10B 100 Tests

TLR2 (Toll Like Receptor 2, Toll-like Receptor 2 Precursor, TLR 2, TLR-2, CD282, CD282 Antigen, Toll/interleukin 1 Receptor-like 4, Toll/interleukin Receptor-like Protein 4, TIL4) (Carboxyfluorescein) discontinued

Sign In for Pricing
View Details
1- (4-Amino-phenyl) -propane-1,2,3-triol
sc-302275 500 mg

1- (4-Amino-phenyl) -propane-1,2,3-triol

Sign In for Pricing
View Details
CRTH2 (PTGDR2, Prostaglandin D2 Receptor 2, Chemoattractant Receptor-homologous Molecule Expressed on Th2 Cells, G-protein Coupled Receptor 44, CD294, DL1R, GPR44) (AP)
MBS6400273-01 0.1 mL

CRTH2 (PTGDR2, Prostaglandin D2 Receptor 2, Chemoattractant Receptor-homologous Molecule Expressed on Th2 Cells, G-protein Coupled Receptor 44, CD294, DL1R, GPR44) (AP)

Sign In for Pricing
View Details
CRTH2 (PTGDR2, Prostaglandin D2 Receptor 2, Chemoattractant Receptor-homologous Molecule Expressed on Th2 Cells, G-protein Coupled Receptor 44, CD294, DL1R, GPR44) (AP)
MBS6400273-02 5x 0.1 mL

CRTH2 (PTGDR2, Prostaglandin D2 Receptor 2, Chemoattractant Receptor-homologous Molecule Expressed on Th2 Cells, G-protein Coupled Receptor 44, CD294, DL1R, GPR44) (AP)

Sign In for Pricing
View Details
GRB10 Protein Vector (Rat) (pPM-C-His)
PV271441 500 ng

GRB10 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Monoclonal FoxP3 Antibody (FOXP3/8145R) [Alexa Fluor 405]
NBP3-20858AF405 0.1 mL

Rabbit Monoclonal FoxP3 Antibody (FOXP3/8145R) [Alexa Fluor 405]

Sign In for Pricing
View Details