Recombinant Rotavirus Non-structural glycoprotein 4, partial
This Recombinant Rotavirus Non-structural glycoprotein 4, partial spans the amino acid sequence from region 73-213aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
UniProt
A9Q1L1
Expression Region
73-213aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219) )
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
21.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QTSKIIYIVRLLFWKMYNVINNLVNKMINREKIADRQIVDNRFREFEERFRILLLQHDENIAKQDNIVQYNKLDNFAESIKSEFNLKVAEMERRFQELKWRCDMIANKTMNTIVLTNTVDSTNKDEKIIFDEGSVVQYNRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15093156 1 Vial
Lentiviral human MKRN3 shRNA (UAS) - Lentiviral human MKRN3 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details MBS1233728-01 0.02 mg (E-Coli)
Recombinant Bacillus cereus CCA-adding enzyme (cca)
Sign In for Pricing
View Details