Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plexin-B1 (PLXNB1), partial

This Recombinant Human Plexin-B1 (PLXNB1), partial spans the amino acid sequence from region 35-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Semaphorin receptor SEP)

UniProt

O43157

Expression Region

35-150aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRP2 DCT Antibody (2A10)
N1455-01 40 µL

TRP2 DCT Antibody (2A10)

Sign In for Pricing
View Details
TRP2 DCT Antibody (2A10)
N1455-02 100 µL

TRP2 DCT Antibody (2A10)

Sign In for Pricing
View Details
TRP2 DCT Antibody (2A10)
N1455-03 200 µL

TRP2 DCT Antibody (2A10)

Sign In for Pricing
View Details
1700006E09Rik CRISPR Activation Plasmid (m)
sc-429079-ACT 20 µg

1700006E09Rik CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
RNT2, NT (RNASET2, RNASE6PL, Ribonuclease T2, Ribonuclease 6) (MaxLight 405)
MBS6343044-01 0.1 mL

RNT2, NT (RNASET2, RNASE6PL, Ribonuclease T2, Ribonuclease 6) (MaxLight 405)

Sign In for Pricing
View Details
RNT2, NT (RNASET2, RNASE6PL, Ribonuclease T2, Ribonuclease 6) (MaxLight 405)
MBS6343044-02 5x 0.1 mL

RNT2, NT (RNASET2, RNASE6PL, Ribonuclease T2, Ribonuclease 6) (MaxLight 405)

Sign In for Pricing
View Details