Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plexin-B1 (PLXNB1), partial

This Recombinant Human Plexin-B1 (PLXNB1), partial spans the amino acid sequence from region 35-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Semaphorin receptor SEP)

UniProt

O43157

Expression Region

35-150aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc71l Mouse shRNA Lentiviral Particle (Locus ID 72123)
TL504695V 500 µL Each

Ccdc71l Mouse shRNA Lentiviral Particle (Locus ID 72123)

Sign In for Pricing
View Details
HAUS3 shRNA Plasmid (h)
sc-89186-SH 20 µg

HAUS3 shRNA Plasmid (h)

Sign In for Pricing
View Details
LOC684871 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV644641 1.0 µg DNA

LOC684871 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Zosuquidar
MBS5802939 Inquire

Zosuquidar

Sign In for Pricing
View Details
Bovine mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit
EIA07013Bo 1 Kit

Bovine mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit

Sign In for Pricing
View Details
TGaseZ Lentiviral Activation Particles (m2)
sc-437041-LAC-2 200 µL

TGaseZ Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details