Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-like protein 11 (BCL2L11)

This Recombinant Human Bcl-2-like protein 11 (BCL2L11) spans the amino acid sequence from region 1-198aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Bcl2-L-11) (Bcl2-interacting mediator of cell death)

UniProt

O43521

Expression Region

1-198aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDIT3 Recombinant Antibody, HRP Conjugated
bsm-52881R-HRP 100 µL

DDIT3 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Chicken ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit
EIA06829Ch 1 Kit

Chicken ATP-sensitive inward rectifier potassium channel 8 (KCNJ8) ELISA Kit

Sign In for Pricing
View Details
TRAF3IP1 Rabbit pAb, Pacific Blue conjugated
orb2845343 100 µL

TRAF3IP1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
CYP39A1 (NM_016593) Human Tagged ORF Clone Lentiviral Particle
RC203058L4V 200 µL

CYP39A1 (NM_016593) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AG-879
MBS515054-01 5 mg

AG-879

Sign In for Pricing
View Details
AG-879
MBS515054-02 25 mg

AG-879

Sign In for Pricing
View Details