Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like 3 (INSL3), partial

This Recombinant Bovine Insulin-like 3 (INSL3), partial spans the amino acid sequence from region 22-66aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Leydig insulin-like peptide) (Ley-I-L) (Relaxin-like factor)

UniProt

O77801

Expression Region

22-66aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPAAAQEAPEKLCGHHFVRALVRLCGGPRWSSEEDGRPVAGGDRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TRF-1 Antibody (3H11) [mFluor Violet 450 SE]
NB120-14397MFV450 0.1 mL

Mouse Monoclonal TRF-1 Antibody (3H11) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Human anti-GST tag mAb
E4A03A02 50 µg

Human anti-GST tag mAb

Sign In for Pricing
View Details
Zfp664 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4620004 1.0 µg DNA

Zfp664 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal SETD8 Antibody
NBP2-55772 100 µL

Rabbit Polyclonal SETD8 Antibody

Sign In for Pricing
View Details
Asah2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3499608 1.0 µg DNA

Asah2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
UCHL1+3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2436316 100 µL

UCHL1+3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details