Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial

This Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial spans the amino acid sequence from region 70-168aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P00289

Expression Region

70-168aa

Tag

Tag-Free

Source

E.coli

Origin

Spinacia oleracea (Spinach)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRN Protein Vector (Rat) (pPM-C-His)
PV271669 500 ng

GRN Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Prd Antibody - middle region
ARP47857_P050-25UL 25 µL

Prd Antibody - middle region

Sign In for Pricing
View Details
RFTN2 Peptide - N-terminal region
orb2009232 100 µg

RFTN2 Peptide - N-terminal region

Sign In for Pricing
View Details
SNHG7 siRNA Oligos set (Human)
44560171 3x 5 nmol

SNHG7 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Psychrobacter sp. Fructose-1,6-bisphosphatase class 1 (fbp)
MBS1123083-01 0.02 mg (E-Coli)

Recombinant Psychrobacter sp. Fructose-1,6-bisphosphatase class 1 (fbp)

Sign In for Pricing
View Details
Recombinant Psychrobacter sp. Fructose-1,6-bisphosphatase class 1 (fbp)
MBS1123083-02 0.02 mg (Yeast)

Recombinant Psychrobacter sp. Fructose-1,6-bisphosphatase class 1 (fbp)

Sign In for Pricing
View Details