Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta constant 1 (TRBC1), partial, Biotinylated

This Recombinant Human T cell receptor beta constant 1 (TRBC1), partial, Biotinylated spans the amino acid sequence from region 1-129aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P01850

Expression Region

1-129aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XYLT2, NT (XYLT2, XT2, Xylosyltransferase 2, Peptide O-xylosyltransferase 1, Xylosyltransferase II) (PE) discontinued
043942-PE 200 µL

XYLT2, NT (XYLT2, XT2, Xylosyltransferase 2, Peptide O-xylosyltransferase 1, Xylosyltransferase II) (PE) discontinued

Sign In for Pricing
View Details
Human Sarcolipin (SLN) ELISA Kit
DL-SLN-Hu-01 48 Tests

Human Sarcolipin (SLN) ELISA Kit

Sign In for Pricing
View Details
Human Sarcolipin (SLN) ELISA Kit
DL-SLN-Hu-02 96 Tests

Human Sarcolipin (SLN) ELISA Kit

Sign In for Pricing
View Details
MMP 13 antibody
20R-1631 100 ug

MMP 13 antibody

Sign In for Pricing
View Details
FBXO6 siRNA (Rat)
CRR3533-01 15 nmol

FBXO6 siRNA (Rat)

Sign In for Pricing
View Details
FBXO6 siRNA (Rat)
CRR3533-02 30 nmol

FBXO6 siRNA (Rat)

Sign In for Pricing
View Details