Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Triplex capsid protein 1 (TRX1)

This Recombinant Epstein-Barr virus Triplex capsid protein 1 (TRX1) spans the amino acid sequence from region 1-364aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P03187

Expression Region

1-364aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKVQGSVDRRRLQRRIAGLLPPPARRLNISRGSEFTRDVRGLVEEHAQASSLSAAAVWRAGLLAPGEVAVAGGGSGGGSFSWSGWRPPVFGDFLIHASSFNNAEATGTPLFQFKQSDPFSGVDAVFTPLSLFILMNHGRGVAARVEAGGGLTRMANLLYDSPATLADLVPDFGRLVADRRFHNFITPVGPLVENIKSTYLNKITTVVHGPVVSKAIPRSTVKVTVPQEAFVDLDAWLSGGAGGGGGVCFVGGLGLQPCPADARLYVALTYEEAGPRFTFFQSSRGHCQIMNILRIYYSPSIMHRYAVVQPLHIEELTFGAVACLGTFSATDGWRRSAFNYRGSSLPVVEIDSFYSNVSDWEVIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 5 (CLDN5)
C5838-47A 100 µg

Claudin 5 (CLDN5)

Sign In for Pricing
View Details
Mprip Rat shRNA Lentiviral Particle (Locus ID 116504)
TL712172V 500 µL Each

Mprip Rat shRNA Lentiviral Particle (Locus ID 116504)

Sign In for Pricing
View Details
Rat Inducible T-Cell Co Stimulator Ligand (ICOSLG) ELISA Kit
abx255738-01 96 Tests

Rat Inducible T-Cell Co Stimulator Ligand (ICOSLG) ELISA Kit

Sign In for Pricing
View Details
Rat Inducible T-Cell Co Stimulator Ligand (ICOSLG) ELISA Kit
abx255738-02 5x 96 Tests

Rat Inducible T-Cell Co Stimulator Ligand (ICOSLG) ELISA Kit

Sign In for Pricing
View Details
Rat Inducible T-Cell Co Stimulator Ligand (ICOSLG) ELISA Kit
abx255738-03 10x 96 Tests

Rat Inducible T-Cell Co Stimulator Ligand (ICOSLG) ELISA Kit

Sign In for Pricing
View Details
ING3 antibody
70R-2097 50 ug

ING3 antibody

Sign In for Pricing
View Details