Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calbindin (CALB1)

This Recombinant Human Calbindin (CALB1) spans the amino acid sequence from region 2-261aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Calbindin D28) (D-28K) (Vitamin D-dependent calcium-binding protein, avian-type)

UniProt

P05937

Expression Region

2-261aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS635505 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
ANO8 Human Gene Knockout Kit (CRISPR)
KN424171 1 Kit

ANO8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SH3D19 (NM_001009555) Human Over-expression Lysate
LC432388 20 µg

SH3D19 (NM_001009555) Human Over-expression Lysate

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), CF568 conjugate, 0.1mg/mL
BNC681921-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Psg17 Mouse Gene Knockout Kit (CRISPR)
KN514075 1 Kit

Psg17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Myeloid tissue
CB630656 1 Block

Frozen Tissue Blocks, Myeloid tissue

Sign In for Pricing
View Details