Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin beta B chain protein (INHBB), partial

This Recombinant Human Inhibin beta B chain protein (INHBB), partial spans the amino acid sequence from region 295-405aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Activin beta-B chain)

UniProt

P09529

Expression Region

295-405aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2I Rabbit pAb
E45R20143N-100 100 µL

UBE2I Rabbit pAb

Sign In for Pricing
View Details
TYRO3 Mouse Monoclonal Antibody [Clone ID: OTI9B12]
TA500421S 30 µL

TYRO3 Mouse Monoclonal Antibody [Clone ID: OTI9B12]

Sign In for Pricing
View Details
Cybb 3'UTR GFP Stable Cell Line
TU253021 1.0 mL

Cybb 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Porcine NKB (Neurokinin B) ValidElisa Kit
EK345581 96 Well

Porcine NKB (Neurokinin B) ValidElisa Kit

Sign In for Pricing
View Details
Slc16a6 AAV siRNA Pooled Vector
43902166 1.0 µg

Slc16a6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human IL-6 Recombinant Antibody, APC-Cy7 Conjugated
bsm-10807R-APC-Cy7 100 µL

Human IL-6 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details