Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes DNA-binding protein HU (hup)

This Recombinant Streptococcus pyogenes DNA-binding protein HU (hup) spans the amino acid sequence from region 1-91aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P0C0H2

Expression Region

1-91aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptococcus pyogenes

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIEIAASKVPAFKAGKALKDAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Delamanid
C6368-5 5 mg

Delamanid

Sign In for Pricing
View Details
Streptococcus Pneumonia 23 serotypes IgM Antibody ELISA Kit, Human
VACY-1022-CY552 1 Kit

Streptococcus Pneumonia 23 serotypes IgM Antibody ELISA Kit, Human

Sign In for Pricing
View Details
Rskn-1 Antibody
orb800793 2 mg

Rskn-1 Antibody

Sign In for Pricing
View Details
COL6A1 (Biotin)
559084-01 50 µL

COL6A1 (Biotin)

Sign In for Pricing
View Details
COL6A1 (Biotin)
559084-02 100 µL

COL6A1 (Biotin)

Sign In for Pricing
View Details
Lck rabbit pAb Antibody
orb768971-01 50 μL

Lck rabbit pAb Antibody

Sign In for Pricing
View Details