Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes DNA-binding protein HU (hup)

This Recombinant Streptococcus pyogenes DNA-binding protein HU (hup) spans the amino acid sequence from region 1-91aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P0C0H2

Expression Region

1-91aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptococcus pyogenes

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIEIAASKVPAFKAGKALKDAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Clvs2 qPCR Primer Pair
QM55682S 200 Tests

Mouse Clvs2 qPCR Primer Pair

Sign In for Pricing
View Details
GHSR siRNA Oligos set (Human)
21502171 3x 5 nmol

GHSR siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mouse Bcl6b/B-cell CLL/lymphoma 6 member B protein ELISA Kit
orb1661963 96 Tests

Mouse Bcl6b/B-cell CLL/lymphoma 6 member B protein ELISA Kit

Sign In for Pricing
View Details
Mouse Transcription Factor SOX 3,SOX3 ELISA KIT
JOT-EK0909Mo-01 96 Well

Mouse Transcription Factor SOX 3,SOX3 ELISA KIT

Sign In for Pricing
View Details
Mouse Transcription Factor SOX 3,SOX3 ELISA KIT
JOT-EK0909Mo-02 48 Well

Mouse Transcription Factor SOX 3,SOX3 ELISA KIT

Sign In for Pricing
View Details
GNG7 Peptide
DF9562-BP 1 mg

GNG7 Peptide

Sign In for Pricing
View Details