Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial, Biotinylated

This Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial, Biotinylated spans the amino acid sequence from region 609-925aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CP-H) (Protein II)

UniProt

P11820

Expression Region

609-925aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Human adenovirus F serotype 41 (HAdV-41) (Human adenovirus 41)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

84.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NDTNDQSFNDYLCAANMLYPIPSNATSVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFTYSGSVPYLDGTFYLNHTFKKVSIMFDSSVSWPGNDRLLTPNEFEIKRTVDGEGYNVAQCNMTKDWFLIQMLSHYNIGYQGFYVPESYKDRMYSFFRNFQPMSRQVVNTTTYKEYQNVTLPFQHNNSGFVGYMGPTMREGQAYPANYPYPLIGQTAVPSLTQKKFLCDRTMWRIPFSSNFMSMGALTDLGQNMLYANSAHALDMTFEVDPMDEPTLLYVLFEVFDVVRIHQPHRGVIEAVYLRTPFSAGNATT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pleuronectes platessa Cytochrome P450 1A1 (cyp1a1), partial
MBS1377436 Inquire

Recombinant Pleuronectes platessa Cytochrome P450 1A1 (cyp1a1), partial

Sign In for Pricing
View Details
REC104 Antibody
orb849143 2 mg

REC104 Antibody

Sign In for Pricing
View Details
Anti-cleaved Caspase-9 CASP9 Rabbit Monoclonal Antibody
M00080-2 100 µL/Vial

Anti-cleaved Caspase-9 CASP9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Pyruvate Kinase Antibody
abx025116-01 50 µL

Pyruvate Kinase Antibody

Sign In for Pricing
View Details
Pyruvate Kinase Antibody
abx025116-02 200 µL

Pyruvate Kinase Antibody

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody (APC)
abx140526 100 Tests

Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody (APC)

Sign In for Pricing
View Details