Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

This Recombinant Dog T-cell surface glycoprotein CD8 alpha chain (CD8A), partial spans the amino acid sequence from region 22-186aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CD antigen CD8a)

UniProt

P33706

Expression Region

22-186aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGPSRFRMTPPKVVGQLHAQVELQCQVLLSTAAPGCSWLYQRNEPAARPVFLMYISQSRAKPAEGLDTKHISGQKKTDSTYSLTLSRFRKEDEGYYFCSVLSNSILYFSPFVPVFLPVKPPTTPAPRPPTRAPTNASKPVSPRGETCRPAAGSAVKTSGLDFACE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Adrenal gland
CS639347 5x 5 µm

Frozen Tissue Sections, Adrenal gland

Sign In for Pricing
View Details
TCF25 Polyclonal Antibody
E-AB-52659-01 20 µL

TCF25 Polyclonal Antibody

Sign In for Pricing
View Details
TCF25 Polyclonal Antibody
E-AB-52659-02 60 µL

TCF25 Polyclonal Antibody

Sign In for Pricing
View Details
TCF25 Polyclonal Antibody
E-AB-52659-03 120 µL

TCF25 Polyclonal Antibody

Sign In for Pricing
View Details
TCF25 Polyclonal Antibody
E-AB-52659-04 200 µL

TCF25 Polyclonal Antibody

Sign In for Pricing
View Details
LGSN (NM_016571) Human Recombinant Protein
TP320287L 1 mg

LGSN (NM_016571) Human Recombinant Protein

Sign In for Pricing
View Details