Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Keratin, type II cytoskeletal 2 epidermal (KRT2)

This Recombinant Human Keratin, type II cytoskeletal 2 epidermal (KRT2) spans the amino acid sequence from region 1-639aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cytokeratin-2e) (CK-2e) (Epithelial keratin-2e) (Keratin-2 epidermis) (Keratin-2e) (K2e) (Type-II keratin Kb2)

UniProt

P35908

Expression Region

1-639aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

72.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQDAIADAEQRGEHALKDARNKLNDLEEALQQAKEDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGDLSSNVTVSVTSSTISSNVASKAAFGGSGGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGSSSGGGYGSGGGGSSSVKGSSGEAFGSSVTFSFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[KO Validated] Rad23B Rabbit pAb
E45R29421N-100 100 µL

[KO Validated] Rad23B Rabbit pAb

Sign In for Pricing
View Details
2- (4-Chlorophenyl) -4-methylpentanoic acid
IBA12705-01 100 mg

2- (4-Chlorophenyl) -4-methylpentanoic acid

Sign In for Pricing
View Details
2- (4-Chlorophenyl) -4-methylpentanoic acid
IBA12705-02 1 g

2- (4-Chlorophenyl) -4-methylpentanoic acid

Sign In for Pricing
View Details
Tissue Factor (13K19) Rabbit Monoclonal Antibody
E28M3043 100 µL

Tissue Factor (13K19) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MORN1 (NM_024848) Human Tagged Lenti ORF Clone
RC215575L4 10 µg

MORN1 (NM_024848) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit WD repeat-containing protein 48 (WDR48) ELISA Kit
MBS7210584-01 48 Well

Rabbit WD repeat-containing protein 48 (WDR48) ELISA Kit

Sign In for Pricing
View Details