Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD9 antigen (Cd9), partial

This Recombinant Mouse CD9 antigen (Cd9), partial spans the amino acid sequence from region 110-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P40240

Expression Region

110-193aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-p38 Polyclonal Antibody
MBS194397-01 0.1 mL

Anti-p38 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-p38 Polyclonal Antibody
MBS194397-02 5x 0.1 mL

Anti-p38 Polyclonal Antibody

Sign In for Pricing
View Details
RAN Protein Vector (Mouse) (pPM-C-His)
PV222269 500 ng

RAN Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Advanced Glycation End Product High Sensitivity ELISA Kit
ECP7802 96 Tests

Advanced Glycation End Product High Sensitivity ELISA Kit

Sign In for Pricing
View Details
Lilrc2 (NM_001100123) Rat Tagged Lenti ORF Clone
RR210539L4 10 µg

Lilrc2 (NM_001100123) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Pongo abelii Zinc finger protein 136 (ZNF136), partial
MBS1410259 Inquire

Recombinant Pongo abelii Zinc finger protein 136 (ZNF136), partial

Sign In for Pricing
View Details