Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD9 antigen (Cd9), partial

This Recombinant Mouse CD9 antigen (Cd9), partial spans the amino acid sequence from region 110-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P40240

Expression Region

110-193aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KCNH1 Antibody Picoband® Fluoro488 Conjugated
A01036-3-Fluoro488 100 µg/Vial

Anti-KCNH1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
GAS7 (Growth Arrest-specific Protein 7, GAS-7, KIAA0394) (HRP)
MBS6152635-01 0.1 mL

GAS7 (Growth Arrest-specific Protein 7, GAS-7, KIAA0394) (HRP)

Sign In for Pricing
View Details
GAS7 (Growth Arrest-specific Protein 7, GAS-7, KIAA0394) (HRP)
MBS6152635-02 5x 0.1 mL

GAS7 (Growth Arrest-specific Protein 7, GAS-7, KIAA0394) (HRP)

Sign In for Pricing
View Details
Syringe Filter, CA, 0.80μm,13mm, 50/Pk, Green, Sterile
FJ13ASCCA008EL01 50 Pieces/Case:50 Pieces/ PACKS:1 PACKS/CASE

Syringe Filter, CA, 0.80μm,13mm, 50/Pk, Green, Sterile

Sign In for Pricing
View Details
Human TNFAIP6 (Tumor necrosis factor-inducible gene 6 protein) QuickTest ELISA Kit
MBS7619232-01 48 Well

Human TNFAIP6 (Tumor necrosis factor-inducible gene 6 protein) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human TNFAIP6 (Tumor necrosis factor-inducible gene 6 protein) QuickTest ELISA Kit
MBS7619232-02 96 Well

Human TNFAIP6 (Tumor necrosis factor-inducible gene 6 protein) QuickTest ELISA Kit

Sign In for Pricing
View Details