Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fos-related antigen 1 (Fosl1)

This Recombinant Mouse Fos-related antigen 1 (Fosl1) spans the amino acid sequence from region 1-273aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FRA-1)

UniProt

P48755

Expression Region

1-273aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYRDYGEPGPSSGAGSPYGRPAQPPQAQAQTAQQQKFHLVPSIDSSSQELHWMVQPHFLGPTGYPRPLAYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGDKKDPGGSGSTSGASSPPAPGRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCSSAHRKSSSSSGDPSSDPLGSPTLLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMD1 Blocking Peptide
33R-5846 100 ug

LIMD1 Blocking Peptide

Sign In for Pricing
View Details
Protein C2orf64 (C2orf64) Human ELISA Kit
G2521 96 Tests

Protein C2orf64 (C2orf64) Human ELISA Kit

Sign In for Pricing
View Details
TMPRSS9 Antibody (N-term)
orb32096-01 50 µL

TMPRSS9 Antibody (N-term)

Sign In for Pricing
View Details
TMPRSS9 Antibody (N-term)
orb32096-02 100 µL

TMPRSS9 Antibody (N-term)

Sign In for Pricing
View Details
PD-1 Biosimilar Antibody
orb2670499-01 50 µg

PD-1 Biosimilar Antibody

Sign In for Pricing
View Details
PD-1 Biosimilar Antibody
orb2670499-02 100 µg

PD-1 Biosimilar Antibody

Sign In for Pricing
View Details