Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide Y receptor type 2 (NPY2R), partial

This Recombinant Human Neuropeptide Y receptor type 2 (NPY2R), partial spans the amino acid sequence from region 326-381aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(NPY2-R) (NPY-Y2 receptor) (Y2 receptor)

UniProt

P49146

Expression Region

326-381aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cited1 shRNA (UAS) - Lentiviral mouse Cited1 shRNA (UAS, RFP) (25)
GTR15120455 1 Vial

Lentiviral mouse Cited1 shRNA (UAS) - Lentiviral mouse Cited1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
RAB11FIP3 Antibody
OAAF04111-100UG 100 µg

RAB11FIP3 Antibody

Sign In for Pricing
View Details
Mouse Cystatin D/Cst10 Affinity Purified Polyclonal Ab
AF6255 100 µg

Mouse Cystatin D/Cst10 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Human C-Type Natriuretic Peptide (NPPC) Peptide
abx260757-01 5 µg

Human C-Type Natriuretic Peptide (NPPC) Peptide

Sign In for Pricing
View Details
Human C-Type Natriuretic Peptide (NPPC) Peptide
abx260757-02 20 µg

Human C-Type Natriuretic Peptide (NPPC) Peptide

Sign In for Pricing
View Details
Human C-Type Natriuretic Peptide (NPPC) Peptide
abx260757-03 1 mg

Human C-Type Natriuretic Peptide (NPPC) Peptide

Sign In for Pricing
View Details