Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor B (VEGFB), partial

This Recombinant Human Vascular endothelial growth factor B (VEGFB), partial spans the amino acid sequence from region 31-129aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(VEGF-B) (VEGF-related factor) (VRF)

UniProt

P49765

Expression Region

31-129aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr650 Protein Vector (Rat) (pPM-C-HA)
PV290688 500 ng

Olr650 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Olfr44 (NM_146830) AAV Particle
MR213816A1V 250 µL

Mouse Olfr44 (NM_146830) AAV Particle

Sign In for Pricing
View Details
Insulin Receptor R, NT (Insulin Receptor-related Protein, Insulin Receptor-related Receptor, IR-related Receptor, INSRR, IRR) (AP) discontinued
I7661-26R-AP 200 µL

Insulin Receptor R, NT (Insulin Receptor-related Protein, Insulin Receptor-related Receptor, IR-related Receptor, INSRR, IRR) (AP) discontinued

Sign In for Pricing
View Details
Small conductance calcium-activated potassium channel protein 1 (KCNN1) Human ELISA Kit
H1189 96 Tests

Small conductance calcium-activated potassium channel protein 1 (KCNN1) Human ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 4 (IL-4) ELISA Kit
orb1807402-01 48 Tests

Human Interleukin 4 (IL-4) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 4 (IL-4) ELISA Kit
orb1807402-02 96 Tests

Human Interleukin 4 (IL-4) ELISA Kit

Sign In for Pricing
View Details