Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Curli assembly protein CsgC (csgC)

This Recombinant Escherichia coli Curli assembly protein CsgC (csgC) spans the amino acid sequence from region 9-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P52107

Expression Region

9-110aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALSSQITFNTTQQGDVYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPPSSEKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 1 Receptor Associated Kinase 2,IRAK2 ELISA KIT
JOT-EK0756Mo-01 96 Well

Mouse Interleukin 1 Receptor Associated Kinase 2,IRAK2 ELISA KIT

Sign In for Pricing
View Details
Mouse Interleukin 1 Receptor Associated Kinase 2,IRAK2 ELISA KIT
JOT-EK0756Mo-02 48 Well

Mouse Interleukin 1 Receptor Associated Kinase 2,IRAK2 ELISA KIT

Sign In for Pricing
View Details
Rat Anti-Rat Type I Collagen IgG Antibody Assay Kit, OPD
1024 1 Kit

Rat Anti-Rat Type I Collagen IgG Antibody Assay Kit, OPD

Sign In for Pricing
View Details
FAM131A sgRNA CRISPR Lentivector (Human) (Target 1)
K0745902 1.0 µg DNA

FAM131A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RAB41 Rabbit Polyclonal Antibody
orb304538-01 30 µL

RAB41 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAB41 Rabbit Polyclonal Antibody
orb304538-02 50 μL

RAB41 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details