Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H4 (H4C1)

This Recombinant Human Histone H4 (H4C1) spans the amino acid sequence from region 2-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P62805

Expression Region

2-103aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pmVenus-N1 Plasmid
PVTY00087 2 µg

pmVenus-N1 Plasmid

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Uncharacterized membrane protein PA4757 (PA4757)
MBS1017830 Inquire

Recombinant Pseudomonas aeruginosa Uncharacterized membrane protein PA4757 (PA4757)

Sign In for Pricing
View Details
Cdh13 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7063103 1.0 µg DNA

Cdh13 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human NDUFV2 Protein
E30P4095 20 µg

Recombinant Human NDUFV2 Protein

Sign In for Pricing
View Details
rno-miR-6318 miRNA Antagomir
MBS8321130-01 10 nmol

rno-miR-6318 miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-6318 miRNA Antagomir
MBS8321130-02 20 nmol

rno-miR-6318 miRNA Antagomir

Sign In for Pricing
View Details