Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H4 (H4C1)

This Recombinant Human Histone H4 (H4C1) spans the amino acid sequence from region 2-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P62805

Expression Region

2-103aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS15AP31 CRISPR Knock Out 293T Cell Line (Human)
42130141 1x 10^6 Cells / 1.0 mL

RPS15AP31 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
DUSP14 Human Recombinant Protein
TP725048 50 µg

DUSP14 Human Recombinant Protein

Sign In for Pricing
View Details
APC Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09853E-01 25 µg

APC Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
APC Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09853E-02 100 µg

APC Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
ARSA (C-Term) Mouse mAb
MBS8550906-01 0.1 mL

ARSA (C-Term) Mouse mAb

Sign In for Pricing
View Details
ARSA (C-Term) Mouse mAb
MBS8550906-02 0.1 mL (AF405L)

ARSA (C-Term) Mouse mAb

Sign In for Pricing
View Details