Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18 (Il18) (N36H, M85A, K87G, E90R, V91A, L94K)

This Recombinant Mouse Interleukin-18 (Il18) (N36H, M85A, K87G, E90R, V91A, L94K) spans the amino acid sequence from region 36-192aa (N36H, M85A, K87G, E90R, V91A, L94K) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-18) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)

UniProt

P70380

Expression Region

36-192aa (N36H, M85A, K87G, E90R, V91A, L94K)

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYAYGDSRARGKAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sclareol (~90%)
TRC-S199970-50G 50 g

Sclareol (~90%)

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD90 Antibody[5E10]
E-AB-F1167G-01 20 Tests

PE/Cyanine5 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD90 Antibody[5E10]
E-AB-F1167G-02 100 Tests

PE/Cyanine5 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD90 Antibody[5E10]
E-AB-F1167G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
CF®640R Rabbit Anti-DNP, 2 mg/mL
#20869-250uL 1x 250 µL

CF®640R Rabbit Anti-DNP, 2 mg/mL

Sign In for Pricing
View Details
Human ZNF829 activation kit by CRISPRa
GA117789 1 Kit

Human ZNF829 activation kit by CRISPRa

Sign In for Pricing
View Details