Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macadamia integrifolia Antimicrobial peptide 1

This Recombinant Macadamia integrifolia Antimicrobial peptide 1 spans the amino acid sequence from region 27-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(AMP1) (MiAMP1)

UniProt

P80915

Expression Region

27-102aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macadamia integrifolia (Macadamia nut)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEKT5 Antibody - N-terminal region (ARP69340_P050)
ARP69340_P050 100 µL

TEKT5 Antibody - N-terminal region (ARP69340_P050)

Sign In for Pricing
View Details
Rabbit anti-CD201 Antibody
MBS4507041-01 0.05 mL

Rabbit anti-CD201 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD201 Antibody
MBS4507041-02 0.1 mL

Rabbit anti-CD201 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD201 Antibody
MBS4507041-03 5x 0.1 mL

Rabbit anti-CD201 Antibody

Sign In for Pricing
View Details
RASSF9 Peptide - C-terminal region (AAP66928)
AAP66928-100UG 100 µg

RASSF9 Peptide - C-terminal region (AAP66928)

Sign In for Pricing
View Details
Mouse Monoclonal Galectin-9 Antibody (9M1-3) [Alexa Fluor 405]
NBP3-18530AF405 0.1 mL

Mouse Monoclonal Galectin-9 Antibody (9M1-3) [Alexa Fluor 405]

Sign In for Pricing
View Details