Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macadamia integrifolia Antimicrobial peptide 1

This Recombinant Macadamia integrifolia Antimicrobial peptide 1 spans the amino acid sequence from region 27-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(AMP1) (MiAMP1)

UniProt

P80915

Expression Region

27-102aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macadamia integrifolia (Macadamia nut)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp17l5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3020005 3x 1.0 µg

Usp17l5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal ACE/CD143 Antibody (ACE/3763) [DyLight 755]
NBP3-08558IR 100 µL

Mouse Monoclonal ACE/CD143 Antibody (ACE/3763) [DyLight 755]

Sign In for Pricing
View Details
TSPAN8 ORF Vector (Human) (pORF)
48598011 1.0 µg DNA

TSPAN8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Influenza A (Nucleoprotein) (MaxLight 750) discontinued
I7650-84B-ML750 100 µL

Influenza A (Nucleoprotein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TNFRSF9 Antibody
A26009-100UG 100 µg

TNFRSF9 Antibody

Sign In for Pricing
View Details
ARF3 (NM_001659) Human Tagged ORF Clone
RC206192 10 µg

ARF3 (NM_001659) Human Tagged ORF Clone

Sign In for Pricing
View Details