Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macadamia integrifolia Antimicrobial peptide 1

This Recombinant Macadamia integrifolia Antimicrobial peptide 1 spans the amino acid sequence from region 27-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(AMP1) (MiAMP1)

UniProt

P80915

Expression Region

27-102aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macadamia integrifolia (Macadamia nut)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pam Mouse shRNA Lentiviral Particle (Locus ID 18484)
TL501574V 500 µL Each

Pam Mouse shRNA Lentiviral Particle (Locus ID 18484)

Sign In for Pricing
View Details
17-beta-hydroxysteroid dehydrogenase 13 Antibody / HSD17B13
V5744-20UG 20 µg

17-beta-hydroxysteroid dehydrogenase 13 Antibody / HSD17B13

Sign In for Pricing
View Details
OR4D10 (NM_001004705) Human Tagged ORF Clone
RG224935 10 µg

OR4D10 (NM_001004705) Human Tagged ORF Clone

Sign In for Pricing
View Details
Caspase-3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61071R-BF555-01 20 µL

Caspase-3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Caspase-3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61071R-BF555-02 100 µL

Caspase-3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Duck Rho GDP-Dissociation Inhibitor 1 (ARHGDIA) ELISA Kit
MBS9940226 Inquire

Duck Rho GDP-Dissociation Inhibitor 1 (ARHGDIA) ELISA Kit

Sign In for Pricing
View Details